PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010521886.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 599aa    MW: 66897.9 Da    PI: 4.3494
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010521886.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65.2e-07443485145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r rW++ + e+++++++++G++  + I + ++  Rt++q k+++ 
   XP_010521886.1 443 RARWSKLDTERFYEGIREFGSD-LSMIQQLFP-DRTREQMKLKYK 485
                      569*******************.*********.*********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.96E-8435491IPR009057Homeodomain-like
PfamPF159638.4E-25436520No hitNo description
PROSITE profilePS512939.078441492IPR017884SANT domain
SMARTSM007172.7E-5442490IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-4442486IPR009057Homeodomain-like
CDDcd001675.26E-4445485No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MDLDDIFLEP AAAGARAGGK FKPKAKPRPK KLASVSAAAE LPNGNEETPP MQDLSCGGED  60
PDGLKGEVAR TKSANLSNTL PSETVVPDSG TINQFTDGTI LEENADVFSG GIHSSMEAAA  120
LHPWTNVDSE KRMDDNIDIP VFPGYPGTQD SVMFTDFIAP EIDGGIHAQN GGTQTEEEEY  180
CLDMETLDII EKGTTTYGQH SGKFQPKPKF QDDVQTRNQS QDVNETPKSV YAADDIDYVS  240
MGASTSEFLV NGDLRNETTN AQNNFYGDFQ EVDIPEMAGE PTSKTEKEIP SGGWEHEEHF  300
ECQGNSTPTE EDNCWEHMAE GQSERARDMG KSKRDAFAEK KPTQKGQNGN EAPDQSGEKP  360
PKKFKHSTRR QRRRALSKEL LETPDEDIPF LPIREMLQLV DYKEWLEKKE AKEAGSTQNQ  420
ERKASDDFEP LLNYHTYVQR QARARWSKLD TERFYEGIRE FGSDLSMIQQ LFPDRTREQM  480
KLKYKSEERR HPMKLNNALA TRVKNHYHYQ SVMKKLQEAA AKAANEKDEA SADDDSPNIE  540
AETTDVPNND EPMKSEPSER DGDAAEGNQS DGGGTAEDVR SDGGDDEDDA YWNSYQSEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1368373RRQRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1626091e-156EU162609.1 Cleome spinosa clone contig83 BAC sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010521886.10.0PREDICTED: uncharacterized protein LOC104800691
TrEMBLB2BXP40.0B2BXP4_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51542535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.11e-110MYB_related family protein